DNHD1 polyclonal antibody View larger

DNHD1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNHD1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about DNHD1 polyclonal antibody

Brand: Abnova
Reference: PAB23571
Product name: DNHD1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DNHD1.
Isotype: IgG
Gene id: 144132
Gene name: DNHD1
Gene alias: DHCD1|FLJ32752|FLJ46184
Gene description: dynein heavy chain domain 1
Immunogen: Recombinant protein corresponding to amino acids of human DNHD1.
Immunogen sequence/protein sequence: KHSQATQPMLILLPPPGHPSATLHPLTVIQKLAAKYQQGQKQLQVIALGSEAWDPVSVVVSTLSQAMYEGHWLVLDNCHLMPHW
Protein accession: Q96M86
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23571-48-1-1.jpg
Application image note: Immunohistochemical staining of human lung with DNHD1 polyclonal antibody (Cat # PAB23571) shows strong cytoplasmic positivity in macrophages.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy DNHD1 polyclonal antibody now

Add to cart