INTS10 polyclonal antibody View larger

INTS10 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of INTS10 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about INTS10 polyclonal antibody

Brand: Abnova
Reference: PAB23514
Product name: INTS10 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant INTS10.
Isotype: IgG
Gene id: 55174
Gene name: INTS10
Gene alias: C8orf35|FLJ10569|INT10
Gene description: integrator complex subunit 10
Immunogen: Recombinant protein corresponding to amino acids of human INTS10.
Immunogen sequence/protein sequence: KGRRSYGDILHRMKDLCRYMNNFDSEAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLEDVSNVYGD
Protein accession: Q9NVR2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23514-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with INTS10 polyclonal antibody (Cat # PAB23514) shows strong cytoplasmic and membranous positivity in tubular cells at 1:1000-1:2500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy INTS10 polyclonal antibody now

Add to cart