CD99L2 polyclonal antibody View larger

CD99L2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD99L2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about CD99L2 polyclonal antibody

Brand: Abnova
Reference: PAB23507
Product name: CD99L2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CD99L2.
Isotype: IgG
Gene id: 83692
Gene name: CD99L2
Gene alias: CD99B|DKFZp761H2024|MIC2L1
Gene description: CD99 molecule-like 2
Immunogen: Recombinant protein corresponding to amino acids of human CD99L2.
Immunogen sequence/protein sequence: DDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEP
Protein accession: Q8TCZ2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23507-48-305-1.jpg
Application image note: Immunohistochemical staining of human bronchus with CD99L2 polyclonal antibody (Cat # PAB23507) shows strong membranous positivity in respiratory epithelial cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CD99L2 polyclonal antibody now

Add to cart