MADD polyclonal antibody View larger

MADD polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MADD polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about MADD polyclonal antibody

Brand: Abnova
Reference: PAB23504
Product name: MADD polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MADD.
Isotype: IgG
Gene id: 8567
Gene name: MADD
Gene alias: DENN|FLJ35600|FLJ36300|IG20|KIAA0358|RAB3GEP
Gene description: MAP-kinase activating death domain
Immunogen: Recombinant protein corresponding to amino acids of human MADD.
Immunogen sequence/protein sequence: YSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQ
Protein accession: Q8WXG6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23504-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with MADD polyclonal antibody (Cat # PAB23504) at 1-4 ug/mL dilution shows positivity in plasma membrane.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MADD polyclonal antibody now

Add to cart