SPAG9 polyclonal antibody View larger

SPAG9 polyclonal antibody

PAB23483_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPAG9 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about SPAG9 polyclonal antibody

Brand: Abnova
Reference: PAB23483
Product name: SPAG9 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SPAG9.
Isotype: IgG
Gene id: 9043
Gene name: SPAG9
Gene alias: FLJ13450|FLJ14006|FLJ26141|FLJ34602|HLC4|JLP|KIAA0516|MGC117291|MGC14967|MGC74461|PHET|PIG6
Gene description: sperm associated antigen 9
Immunogen: Recombinant protein corresponding to amino acids of human SPAG9.
Immunogen sequence/protein sequence: SGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSN
Protein accession: O60271
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23483-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251 MG with SPAG9 polyclonal antibody (Cat # PAB23483) at 1-4 ug/mL dilution shows positivity in cytoplasm.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SPAG9 polyclonal antibody now

Add to cart