VPS51 polyclonal antibody View larger

VPS51 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VPS51 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about VPS51 polyclonal antibody

Brand: Abnova
Reference: PAB23439
Product name: VPS51 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant VPS51.
Isotype: IgG
Gene id: 738
Gene name: VPS51
Gene alias: PP5382|ANG2|ANG3|C11orf2|C11orf3|FFR
Gene description: vacuolar protein sorting 51 homolog (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human VPS51.
Immunogen sequence/protein sequence: FDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIRKMKNDFRKMEDEMDRLATNMAVITDFS
Protein accession: Q9UID3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23439-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with VPS51 polyclonal antibody (Cat # PAB23439) shows strong nuclear and cytoplasmic positivity in Purkinje cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy VPS51 polyclonal antibody now

Add to cart