CDAN1 polyclonal antibody View larger

CDAN1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDAN1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CDAN1 polyclonal antibody

Brand: Abnova
Reference: PAB23425
Product name: CDAN1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CDAN1.
Isotype: IgG
Gene id: 146059
Gene name: CDAN1
Gene alias: CDA-I|CDA1|CDAI|DLT|PRO1295|codanin
Gene description: congenital dyserythropoietic anemia, type I
Immunogen: Recombinant protein corresponding to amino acids of human CDAN1.
Immunogen sequence/protein sequence: NCVKHIKATLVADLVRQAESLLQEQLVTQGEEGGDPAQLLEILCSQLCPHGAQALALGREFCQRKSPGAVRALLPEETPAAVLSSAENIAVGLA
Protein accession: Q8IWY9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23425-48-258-1.jpg
Application image note: Immunohistochemical staining of human rectum with CDAN1 polyclonal antibody (Cat # PAB23425) shows strong cytoplasmic and membranous positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CDAN1 polyclonal antibody now

Add to cart