CHID1 polyclonal antibody View larger

CHID1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHID1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about CHID1 polyclonal antibody

Brand: Abnova
Reference: PAB23421
Product name: CHID1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CHID1.
Isotype: IgG
Gene id: 66005
Gene name: CHID1
Gene alias: FLJ42707|GL008|MGC3234|SI-CLP
Gene description: chitinase domain containing 1
Immunogen: Recombinant protein corresponding to amino acids of human CHID1.
Immunogen sequence/protein sequence: KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV
Protein accession: Q9BWS9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23421-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with CHID1 polyclonal antibody (Cat # PAB23421) shows strong cytoplasmic positivity in glandular cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CHID1 polyclonal antibody now

Add to cart