ERP29 polyclonal antibody View larger

ERP29 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ERP29 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about ERP29 polyclonal antibody

Brand: Abnova
Reference: PAB23419
Product name: ERP29 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ERP29.
Isotype: IgG
Gene id: 10961
Gene name: ERP29
Gene alias: C12orf8|ERp28|ERp31|PDI-DB
Gene description: endoplasmic reticulum protein 29
Immunogen: Recombinant protein corresponding to amino acids of human ERP29.
Immunogen sequence/protein sequence: SYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSV
Protein accession: P30040
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23419-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with ERP29 polyclonal antibody (Cat # PAB23419) shows strong cytoplasmic and membranous positivity in glandular cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy ERP29 polyclonal antibody now

Add to cart