DCUN1D2 polyclonal antibody View larger

DCUN1D2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DCUN1D2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about DCUN1D2 polyclonal antibody

Brand: Abnova
Reference: PAB23416
Product name: DCUN1D2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DCUN1D2.
Isotype: IgG
Gene id: 55208
Gene name: DCUN1D2
Gene alias: C13orf17|FLJ10704|FLJ20092
Gene description: DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human DCUN1D2.
Immunogen sequence/protein sequence: QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY
Protein accession: Q6PH85
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23416-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with DCUN1D2 polyclonal antibody (Cat # PAB23416) shows strong granular cytoplasmic positivity in exocrine glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy DCUN1D2 polyclonal antibody now

Add to cart