DEPDC4 polyclonal antibody View larger

DEPDC4 polyclonal antibody

PAB23413_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DEPDC4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about DEPDC4 polyclonal antibody

Brand: Abnova
Reference: PAB23413
Product name: DEPDC4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DEPDC4.
Isotype: IgG
Gene id: 120863
Gene name: DEPDC4
Gene alias: DEP.4|FLJ33505
Gene description: DEP domain containing 4
Immunogen: Recombinant protein corresponding to amino acids of human DEPDC4.
Immunogen sequence/protein sequence: RRTGVHLCQVLMNHKVFEPVGMKKLFKKEKELEFEDSNISLYRFLGNKSSYDCCKRQKDAENEFNETLRPGYEMISNPLAQEIG
Protein accession: Q8N2C3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23413-48-305-1.jpg
Application image note: Immunohistochemical staining of human bronchus with DEPDC4 polyclonal antibody (Cat # PAB23413) shows strong cytoplasmic and membranous positivity in respiratory epithelial cells at 1:50-1:200 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy DEPDC4 polyclonal antibody now

Add to cart