FAXC polyclonal antibody View larger

FAXC polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAXC polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about FAXC polyclonal antibody

Brand: Abnova
Reference: PAB23398
Product name: FAXC polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FAXC.
Isotype: IgG
Gene id: 84553
Gene name: FAXC
Gene alias: C6orf168|dJ273F20
Gene description: failed axon connections homolog (Drosophila)
Immunogen: Recombinant protein corresponding to amino acids of human FAXC.
Immunogen sequence/protein sequence: HFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLG
Protein accession: Q5TGI0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23398-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with FAXC polyclonal antibody (Cat # PAB23398) shows strong cytoplasmic positivity in cells in seminiferus ducts at 1:200-1:500 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy FAXC polyclonal antibody now

Add to cart