ACRBP polyclonal antibody View larger

ACRBP polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACRBP polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about ACRBP polyclonal antibody

Brand: Abnova
Reference: PAB23393
Product name: ACRBP polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ACRBP.
Isotype: IgG
Gene id: 84519
Gene name: ACRBP
Gene alias: FLJ51160|OY-TES-1|SP32
Gene description: acrosin binding protein
Immunogen: Recombinant protein corresponding to amino acids of human ACRBP.
Immunogen sequence/protein sequence: AQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLRATHGCRNPTLVQLDQYENHGLVPDGAVCSNLPYASWFESFCQFTHYRCS
Protein accession: Q8NEB7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23393-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with ACRBP polyclonal antibody (Cat # PAB23393) shows strong cytoplasmic(acrosomal) positivity in cells of seminiferous ducts.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ACRBP polyclonal antibody now

Add to cart