FAM48A polyclonal antibody View larger

FAM48A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAM48A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about FAM48A polyclonal antibody

Brand: Abnova
Reference: PAB23360
Product name: FAM48A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FAM48A.
Isotype: IgG
Gene id: 55578
Gene name: FAM48A
Gene alias: C13|C13orf19|FP757|P38IP|bA421P11.4
Gene description: family with sequence similarity 48, member A
Immunogen: Recombinant protein corresponding to amino acids of human FAM48A.
Immunogen sequence/protein sequence: DSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGCVIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLICDVHSITSDNHKWTQED
Protein accession: Q8NEM7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23360-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with FAM48A polyclonal antibody (Cat # PAB23360) shows strong nucleolar positivity combined with distinct membranous and cytoplasmic staining in exocrine cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy FAM48A polyclonal antibody now

Add to cart