PHF8 polyclonal antibody View larger

PHF8 polyclonal antibody

PAB23348_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHF8 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about PHF8 polyclonal antibody

Brand: Abnova
Reference: PAB23348
Product name: PHF8 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PHF8.
Isotype: IgG
Gene id: 23133
Gene name: PHF8
Gene alias: DKFZp686E0868|JHDM1F|KIAA1111|MRXSSD|ZNF422
Gene description: PHD finger protein 8
Immunogen: Recombinant protein corresponding to amino acids of human PHF8.
Immunogen sequence/protein sequence: ASPSTQEAIQGMLCMANLQSSSSSPATSSLQAWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDD
Protein accession: Q9UPP1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23348-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with PHF8 polyclonal antibody (Cat # PAB23348) shows strong nuclear and cytoplasmic positivity in neuronal cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy PHF8 polyclonal antibody now

Add to cart