C12orf45 polyclonal antibody View larger

C12orf45 polyclonal antibody

PAB23336_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C12orf45 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about C12orf45 polyclonal antibody

Brand: Abnova
Reference: PAB23336
Product name: C12orf45 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C12orf45.
Isotype: IgG
Gene id: 121053
Gene name: C12orf45
Gene alias: MGC40397
Gene description: chromosome 12 open reading frame 45
Immunogen: Recombinant protein corresponding to amino acids of human C12orf45.
Immunogen sequence/protein sequence: LINSQPKSRKTSTLQTVRIERSPLLDQVQTFLPQMARANEKLRKEMAAAPPGRFNIENIDGPHSKVIQMDVALFEMNQSDSKEVD
Protein accession: Q8N5I9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23336-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with C12orf45 polyclonal antibody (Cat # PAB23336) shows moderate cytoplasmic and nuclear positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C12orf45 polyclonal antibody now

Add to cart