LY6G5C polyclonal antibody View larger

LY6G5C polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LY6G5C polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about LY6G5C polyclonal antibody

Brand: Abnova
Reference: PAB23329
Product name: LY6G5C polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LY6G5C.
Isotype: IgG
Gene id: 80741
Gene name: LY6G5C
Gene alias: C6orf20|G5c|LY6G5CA|LY6G5CB|NG33
Gene description: lymphocyte antigen 6 complex, locus G5C
Immunogen: Recombinant protein corresponding to amino acids of human LY6G5C.
Immunogen sequence/protein sequence: ADLPSCWGAGPCYTGHKVGALRRDTVICCCRHGDYSTPCLFTPGKPSRNPSPWKRTLWT
Protein accession: Q5SRR4
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23329-48-5-1.jpg
Application image note: Immunohistochemical staining of human tonsil with LY6G5C polyclonal antibody (Cat # PAB23329) shows strong cytoplasmic positivity in a subset of cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy LY6G5C polyclonal antibody now

Add to cart