ALG9 polyclonal antibody View larger

ALG9 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ALG9 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about ALG9 polyclonal antibody

Brand: Abnova
Reference: PAB23307
Product name: ALG9 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ALG9.
Isotype: IgG
Gene id: 79796
Gene name: ALG9
Gene alias: DIBD1|DKFZp586M2420|FLJ21845|LOH11CR1J
Gene description: asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human ALG9.
Immunogen sequence/protein sequence: ALFRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQLPKPFAEGPLATRIVPTDMNDQNL
Protein accession: Q9H6U8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23307-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with ALG9 polyclonal antibody (Cat # PAB23307) shows strong cytoplasmic positivity in exocrine glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ALG9 polyclonal antibody now

Add to cart