FRMD4A polyclonal antibody View larger

FRMD4A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FRMD4A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about FRMD4A polyclonal antibody

Brand: Abnova
Reference: PAB23289
Product name: FRMD4A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FRMD4A.
Isotype: IgG
Gene id: 55691
Gene name: FRMD4A
Gene alias: FLJ10210|FRMD4|KIAA1294|bA295P9.4
Gene description: FERM domain containing 4A
Immunogen: Recombinant protein corresponding to amino acids of human FRMD4A.
Immunogen sequence/protein sequence: EGAHDKGAGRAAVSDELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSA
Protein accession: Q9P2Q2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23289-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with FRMD4A polyclonal antibody (Cat # PAB23289) shows strong nuclear positivity in cells in seminiferus ducts.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy FRMD4A polyclonal antibody now

Add to cart