HISPPD1 polyclonal antibody View larger

HISPPD1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HISPPD1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about HISPPD1 polyclonal antibody

Brand: Abnova
Reference: PAB23287
Product name: HISPPD1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant HISPPD1.
Isotype: IgG
Gene id: 23262
Gene name: HISPPD1
Gene alias: FLJ21506|FLJ23463|IP7K2|KIAA0433|PPIP5K2|VIP2
Gene description: histidine acid phosphatase domain containing 1
Immunogen: Recombinant protein corresponding to amino acids of human HISPPD1.
Immunogen sequence/protein sequence: LSVSSPEGTGTWLHYTSGVGTGRRRRRSGEQITSSPVSPKSLAFTSSIFGSWQQVVSENANYLRTPRTLVEQKQNPTVGSHCA
Protein accession: O43314
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23287-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with HISPPD1 polyclonal antibody (Cat # PAB23287) shows strong cytoplasmic positivity in cells in tubules while strong nuclear positivity in cells in glomeruli at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy HISPPD1 polyclonal antibody now

Add to cart