SYNGAP1 polyclonal antibody View larger

SYNGAP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYNGAP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SYNGAP1 polyclonal antibody

Brand: Abnova
Reference: PAB23273
Product name: SYNGAP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SYNGAP1.
Isotype: IgG
Gene id: 8831
Gene name: SYNGAP1
Gene alias: DKFZp761G1421|KIAA1938|RASA1|RASA5|SYNGAP
Gene description: synaptic Ras GTPase activating protein 1 homolog (rat)
Immunogen: Recombinant protein corresponding to amino acids of human SYNGAP1.
Immunogen sequence/protein sequence: LHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLPTGSGGSGGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQ
Protein accession: Q96PV0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23273-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with SYNGAP1 polyclonal antibody (Cat # PAB23273) shows strong cytoplasmic positivity in Leydig cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SYNGAP1 polyclonal antibody now

Add to cart