TMEM165 polyclonal antibody View larger

TMEM165 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMEM165 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TMEM165 polyclonal antibody

Brand: Abnova
Reference: PAB23261
Product name: TMEM165 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TMEM165.
Isotype: IgG
Gene id: 55858
Gene name: TMEM165
Gene alias: TMPT27|TPARL
Gene description: transmembrane protein 165
Immunogen: Recombinant protein corresponding to amino acids of human TMEM165.
Immunogen sequence/protein sequence: REGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQ
Protein accession: Q9HC07
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23261-48-A2-1.jpg
Application image note: Immunohistochemical staining of human colon with TMEM165 polyclonal antibody (Cat # PAB23261) shows strong granular cytoplasmic positivity with additional membranous staining in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy TMEM165 polyclonal antibody now

Add to cart