EPYC polyclonal antibody View larger

EPYC polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EPYC polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about EPYC polyclonal antibody

Brand: Abnova
Reference: PAB23243
Product name: EPYC polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant EPYC.
Isotype: IgG
Gene id: 1833
Gene name: EPYC
Gene alias: DSPG3|PGLB|Pg-Lb|SLRR3B
Gene description: epiphycan
Immunogen: Recombinant protein corresponding to amino acids of human EPYC.
Immunogen sequence/protein sequence: LRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNV
Protein accession: Q99645
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23243-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with EPYC polyclonal antibody (Cat # PAB23243) shows moderate cytoplasmic positivity in cells of seminiferus duct.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy EPYC polyclonal antibody now

Add to cart