SEC24B polyclonal antibody View larger

SEC24B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEC24B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SEC24B polyclonal antibody

Brand: Abnova
Reference: PAB23235
Product name: SEC24B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SEC24B.
Isotype: IgG
Gene id: 10427
Gene name: SEC24B
Gene alias: MGC48822|SEC24
Gene description: SEC24 family, member B (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human SEC24B.
Immunogen sequence/protein sequence: SFQGAASSASHLHTSASQPYSSFVNHYNSPAMYSASSSVASQGFPSTCGHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQNAPTVR
Protein accession: O95487
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23235-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with SEC24B polyclonal antibody (Cat # PAB23235) shows strong cytoplasmic positivity in cells in tubules at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SEC24B polyclonal antibody now

Add to cart