WDR44 polyclonal antibody View larger

WDR44 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WDR44 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,WB-Tr

More info about WDR44 polyclonal antibody

Brand: Abnova
Reference: PAB23219
Product name: WDR44 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant WDR44.
Isotype: IgG
Gene id: 54521
Gene name: WDR44
Gene alias: DKFZp686L20145|MGC26781|RAB11BP|RPH11
Gene description: WD repeat domain 44
Immunogen: Recombinant protein corresponding to amino acids of human WDR44.
Immunogen sequence/protein sequence: MRMKYNTEGRVSPSPSQESLSSSKSDTDTGVCSGTDEDPDDKNAPFRQRPFCKYKGHTADLLDLSWSKNYFLLSSSMDKTVR
Protein accession: Q5JSH3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23219-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with WDR44 polyclonal antibody (Cat # PAB23219) shows nuclear, cytoplasmic and membranous positivity in cells of tubules.
Applications: WB,IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy WDR44 polyclonal antibody now

Add to cart