SPATA7 polyclonal antibody View larger

SPATA7 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPATA7 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SPATA7 polyclonal antibody

Brand: Abnova
Reference: PAB23217
Product name: SPATA7 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SPATA7.
Isotype: IgG
Gene id: 55812
Gene name: SPATA7
Gene alias: DKFZp686D07199|HSD-3.1|HSD3|MGC102934
Gene description: spermatogenesis associated 7
Immunogen: Recombinant protein corresponding to amino acids of human SPATA7.
Immunogen sequence/protein sequence: RHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGV
Protein accession: Q9P0W8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23217-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with SPATA7 polyclonal antibody (Cat # PAB23217) shows strong cytoplasmic positivity in a subset of cells in seminiferous tubules.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SPATA7 polyclonal antibody now

Add to cart