MAP6D1 polyclonal antibody View larger

MAP6D1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP6D1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about MAP6D1 polyclonal antibody

Brand: Abnova
Reference: PAB23199
Product name: MAP6D1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MAP6D1.
Isotype: IgG
Gene id: 79929
Gene name: MAP6D1
Gene alias: FLJ12748|MAPO6D1|SL21
Gene description: MAP6 domain containing 1
Immunogen: Recombinant protein corresponding to amino acids of human MAP6D1.
Immunogen sequence/protein sequence: GKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAWTGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAP
Protein accession: Q9H9H5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23199-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with MAP6D1 polyclonal antibody (Cat # PAB23199) shows strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy MAP6D1 polyclonal antibody now

Add to cart