TTC37 polyclonal antibody View larger

TTC37 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TTC37 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TTC37 polyclonal antibody

Brand: Abnova
Reference: PAB23183
Product name: TTC37 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TTC37.
Isotype: IgG
Gene id: 9652
Gene name: TTC37
Gene alias: KIAA0372|MGC32587
Gene description: tetratricopeptide repeat domain 37
Immunogen: Recombinant protein corresponding to amino acids of human TTC37.
Immunogen sequence/protein sequence: QLGLTYWFMGEETRKDKTKALTHFLKAARLDTYMGKVFCYLGHYYRDVVGDKNRARGCYRKAFELDDTDAESGAAAVDLSVELEDMEMALAILTTVTQK
Protein accession: Q6PGP7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23183-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with TTC37 polyclonal antibody (Cat # PAB23183) shows strong cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy TTC37 polyclonal antibody now

Add to cart