STOX1 polyclonal antibody View larger

STOX1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STOX1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about STOX1 polyclonal antibody

Brand: Abnova
Reference: PAB23175
Product name: STOX1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant STOX1.
Isotype: IgG
Gene id: 219736
Gene name: STOX1
Gene alias: C10orf24|PEE4
Gene description: storkhead box 1
Immunogen: Recombinant protein corresponding to amino acids of human STOX1.
Immunogen sequence/protein sequence: SEFQPGSIRLEKHPKLPATQPIPRIKSPNEMVGQKPLGEITTVLGSHLIYKKRISNPFQGLSHRGSTISKGHKIQKTSDLKPSQTGPKEK
Protein accession: Q6ZVD7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23175-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251 MG with STOX1 polyclonal antibody (Cat # PAB23175) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and cytoplasm.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy STOX1 polyclonal antibody now

Add to cart