TMEM9B polyclonal antibody View larger

TMEM9B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMEM9B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about TMEM9B polyclonal antibody

Brand: Abnova
Reference: PAB23164
Product name: TMEM9B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TMEM9B.
Isotype: IgG
Gene id: 56674
Gene name: TMEM9B
Gene alias: C11orf15
Gene description: TMEM9 domain family, member B
Immunogen: Recombinant protein corresponding to amino acids of human TMEM9B.
Immunogen sequence/protein sequence: EPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQ
Protein accession: Q9NQ34
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23164-48-39-1.jpg
Application image note: Immunohistochemical staining of human urinary bladder with TMEM9B polyclonal antibody (Cat # PAB23164) shows strong cytoplasmic positivity in urothelial cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy TMEM9B polyclonal antibody now

Add to cart