CEP164 polyclonal antibody View larger

CEP164 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CEP164 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about CEP164 polyclonal antibody

Brand: Abnova
Reference: PAB23139
Product name: CEP164 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CEP164.
Isotype: IgG
Gene id: 22897
Gene name: CEP164
Gene alias: KIAA1052
Gene description: centrosomal protein 164kDa
Immunogen: Recombinant protein corresponding to amino acids of human CEP164.
Immunogen sequence/protein sequence: DASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRISEHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHE
Protein accession: Q9UPV0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23139-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251 MG with CEP164 polyclonal antibody (Cat # PAB23139) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and centrosome.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CEP164 polyclonal antibody now

Add to cart