SR140 polyclonal antibody View larger

SR140 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SR140 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about SR140 polyclonal antibody

Brand: Abnova
Reference: PAB23130
Product name: SR140 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SR140.
Isotype: IgG
Gene id: 23350
Gene name: SR140
Gene alias: KIAA0332|MGC133197
Gene description: U2-associated SR140 protein
Immunogen: Recombinant protein corresponding to amino acids of human SR140.
Immunogen sequence/protein sequence: EEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWEL
Protein accession: O15042
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB23130-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with SR140 polyclonal antibody (Cat # PAB23130) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SR140 polyclonal antibody now

Add to cart