ZFYVE27 polyclonal antibody View larger

ZFYVE27 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZFYVE27 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about ZFYVE27 polyclonal antibody

Brand: Abnova
Reference: PAB23125
Product name: ZFYVE27 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZFYVE27.
Isotype: IgG
Gene id: 118813
Gene name: ZFYVE27
Gene alias: PROTRUDIN|RP11-459F3.2|SPG33
Gene description: zinc finger, FYVE domain containing 27
Immunogen: Recombinant protein corresponding to amino acids of human ZFYVE27.
Immunogen sequence/protein sequence: RLRKRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK
Protein accession: Q5T4F4
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23125-48-A2-1.jpg
Application image note: Immunohistochemical staining of human colon with ZFYVE27 polyclonal antibody (Cat # PAB23125) shows moderate granular cytoplasmic positivity in glandular cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy ZFYVE27 polyclonal antibody now

Add to cart