DNAH5 polyclonal antibody View larger

DNAH5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNAH5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about DNAH5 polyclonal antibody

Brand: Abnova
Reference: PAB23115
Product name: DNAH5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DNAH5.
Isotype: IgG
Gene id: 1767
Gene name: DNAH5
Gene alias: CILD3|DNAHC5|FLJ46759|HL1|KIAA1603|KTGNR|PCD
Gene description: dynein, axonemal, heavy chain 5
Immunogen: Recombinant protein corresponding to amino acids of human DNAH5.
Immunogen sequence/protein sequence: EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD
Protein accession: Q8TE73
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23115-48-302-1.jpg
Application image note: Immunohistochemical staining of human nasopharynx with DNAH5 polyclonal antibody (Cat # PAB23115) shows strong positivity in the cilia of respiratory epithelial cells at 1:500-1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy DNAH5 polyclonal antibody now

Add to cart