ARL13A polyclonal antibody View larger

ARL13A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARL13A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ARL13A polyclonal antibody

Brand: Abnova
Reference: PAB23102
Product name: ARL13A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ARL13A.
Isotype: IgG
Gene id: 392509
Gene name: ARL13A
Gene alias: ARL13|dJ341D10.2
Gene description: ADP-ribosylation factor-like 13A
Immunogen: Recombinant protein corresponding to amino acids of human ARL13A.
Immunogen sequence/protein sequence: EETRRNVTIPIIGLNNSGKTVLVEAFQKLLPSKTDHCMKSELTTLLLDEYELSIYDLNGDLKGREAWPNYYAQAHGLVFVLDS
Protein accession: Q5H913
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23102-48-1-1.jpg
Application image note: Immunohistochemical staining of human lung with ARL13A polyclonal antibody (Cat # PAB23102) shows strong cytoplasmic positivity in macrophages at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ARL13A polyclonal antibody now

Add to cart