BANK1 polyclonal antibody View larger

BANK1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BANK1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about BANK1 polyclonal antibody

Brand: Abnova
Reference: PAB23096
Product name: BANK1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant BANK1.
Isotype: IgG
Gene id: 55024
Gene name: BANK1
Gene alias: BANK|FLJ20706|FLJ34204
Gene description: B-cell scaffold protein with ankyrin repeats 1
Immunogen: Recombinant protein corresponding to amino acids of human BANK1.
Immunogen sequence/protein sequence: RHGHKELKKIFEDFSIQEIDINNEQENDYEEDIASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPL
Protein accession: Q8NDB2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23096-48-10-1.jpg
Application image note: Immunohistochemical staining of human lymph node with BANK1 polyclonal antibody (Cat # PAB23096) shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy BANK1 polyclonal antibody now

Add to cart