CWF19L1 polyclonal antibody View larger

CWF19L1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CWF19L1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,IHC-P

More info about CWF19L1 polyclonal antibody

Brand: Abnova
Reference: PAB23076
Product name: CWF19L1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CWF19L1.
Isotype: IgG
Gene id: 55280
Gene name: CWF19L1
Gene alias: FLJ10998
Gene description: CWF19-like 1, cell cycle control (S. pombe)
Immunogen: Recombinant protein corresponding to amino acids of human CWF19L1.
Immunogen sequence/protein sequence: KDVSSLRMMLCTTSQFKGVDILLTSPWPKCVGNFGNSSGEVDTKKCGSALVSSLATGLKPRYHFAALEKTYYERLPYRNHIILQENAQHATRF
Protein accession: Q69YN2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB23076-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with CWF19L1 polyclonal antibody (Cat # PAB23076) shows strong cytoplasmic positivity with a granular staining pattern.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CWF19L1 polyclonal antibody now

Add to cart