FEZ2 polyclonal antibody View larger

FEZ2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FEZ2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about FEZ2 polyclonal antibody

Brand: Abnova
Reference: PAB22936
Product name: FEZ2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FEZ2.
Isotype: IgG
Gene id: 9637
Gene name: FEZ2
Gene alias: HUM3CL|MGC117372
Gene description: fasciculation and elongation protein zeta 2 (zygin II)
Immunogen: Recombinant protein corresponding to amino acids of human FEZ2.
Immunogen sequence/protein sequence: GSYEERVKRLSVSELNEILEEIETAIKEYSEELVQQLALRDELEFEKEVKNSFISVLIEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKNGPPSVEDLQILTKILRAMKEDSEKVPSLLTDYIL
Protein accession: Q9UHY8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22936-12-multi-1.jpg
Application image note: Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with FEZ2 polyclonal antibody (Cat # PAB22936) at 1:250-1:500 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy FEZ2 polyclonal antibody now

Add to cart