VSIG2 polyclonal antibody View larger

VSIG2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VSIG2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about VSIG2 polyclonal antibody

Brand: Abnova
Reference: PAB22923
Product name: VSIG2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant VSIG2.
Isotype: IgG
Gene id: 23584
Gene name: VSIG2
Gene alias: 2210413P10Rik|CTH|CTXL
Gene description: V-set and immunoglobulin domain containing 2
Immunogen: Recombinant protein corresponding to amino acids of human VSIG2.
Immunogen sequence/protein sequence: GQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQ
Protein accession: Q96IQ7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22923-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with VSIG2 polyclonal antibody (Cat # PAB22923) shows strong membranous and cytoplasmic positivity in glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VSIG2 polyclonal antibody now

Add to cart