SIDT1 polyclonal antibody View larger

SIDT1 polyclonal antibody

PAB22918_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SIDT1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SIDT1 polyclonal antibody

Brand: Abnova
Reference: PAB22918
Product name: SIDT1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SIDT1.
Isotype: IgG
Gene id: 54847
Gene name: SIDT1
Gene alias: B830021E24Rik|FLJ20174|SID-1|SID1
Gene description: SID1 transmembrane family, member 1
Immunogen: Recombinant protein corresponding to amino acids of human SIDT1.
Immunogen sequence/protein sequence: SFGSNDGSGNMVASHPIAASTPEGSNYGTIDESSSSPGRQMSSSDGGPPGQSDTDSSVEESDFDTMPDIESDKNIIRTKMFLYLSDLSRKDRRIV
Protein accession: Q9NXL6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22918-48-33-1.jpg
Application image note: Immunohistochemical staining of human prostate with SIDT1 polyclonal antibody (Cat # PAB22918) strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SIDT1 polyclonal antibody now

Add to cart