Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB22886 |
Product name: | ATP11A polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant ATP11A. |
Isotype: | IgG |
Gene id: | 23250 |
Gene name: | ATP11A |
Gene alias: | ATPIH|ATPIS |
Gene description: | ATPase, class VI, type 11A |
Immunogen: | Recombinant protein corresponding to amino acids of human ATP11A. |
Immunogen sequence/protein sequence: | TCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSC |
Protein accession: | P98196 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human kidney with ATP11A polyclonal antibody (Cat # PAB22886) shows strong cytoplasmic and membranous positivity in distal tubules. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |