ATP11A polyclonal antibody View larger

ATP11A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP11A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ATP11A polyclonal antibody

Brand: Abnova
Reference: PAB22886
Product name: ATP11A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ATP11A.
Isotype: IgG
Gene id: 23250
Gene name: ATP11A
Gene alias: ATPIH|ATPIS
Gene description: ATPase, class VI, type 11A
Immunogen: Recombinant protein corresponding to amino acids of human ATP11A.
Immunogen sequence/protein sequence: TCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSC
Protein accession: P98196
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22886-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with ATP11A polyclonal antibody (Cat # PAB22886) shows strong cytoplasmic and membranous positivity in distal tubules.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ATP11A polyclonal antibody now

Add to cart