Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IHC-P |
Brand: | Abnova |
Reference: | PAB22849 |
Product name: | SCARF2 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant SCARF2. |
Isotype: | IgG |
Gene id: | 91179 |
Gene name: | SCARF2 |
Gene alias: | NSR1|SREC-II|SREC2|SRECRP-1 |
Gene description: | scavenger receptor class F, member 2 |
Immunogen: | Recombinant protein corresponding to amino acids of human SCARF2. |
Immunogen sequence/protein sequence: | HHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVP |
Protein accession: | Q96GP6 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SCARF2 polyclonal antibody (Cat # PAB22849) at 1:250-1:500 dilution. |
Applications: | WB,IHC-P |
Shipping condition: | Dry Ice |