ETAA1 polyclonal antibody View larger

ETAA1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ETAA1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about ETAA1 polyclonal antibody

Brand: Abnova
Reference: PAB22845
Product name: ETAA1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ETAA1.
Isotype: IgG
Gene id: 54465
Gene name: ETAA1
Gene alias: ETAA16|FLJ22647
Gene description: Ewing tumor-associated antigen 1
Immunogen: Recombinant protein corresponding to amino acids of human ETAA1.
Immunogen sequence/protein sequence: DMPELFPSKTAHVTDQKEICTFNSKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNK
Protein accession: Q9NY74
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22845-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with ETAA1 polyclonal antibody (Cat # PAB22845) shows distinct nuclear and cytoplasmic positivity in tubular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ETAA1 polyclonal antibody now

Add to cart