Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IHC-P |
Brand: | Abnova |
Reference: | PAB22831 |
Product name: | SF3B14 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant SF3B14. |
Isotype: | IgG |
Gene id: | 51639 |
Gene name: | SF3B14 |
Gene alias: | CGI-110|HSPC175|Ht006|P14|SAP14|SF3B14a |
Gene description: | splicing factor 3B, 14 kDa subunit |
Immunogen: | Recombinant protein corresponding to amino acids of human SF3B14. |
Immunogen sequence/protein sequence: | YEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPP |
Protein accession: | Q9Y3B4 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SF3B14 polyclonal antibody (Cat # PAB22831) at 1:250-1:500 dilution. |
Applications: | WB,IHC-P |
Shipping condition: | Dry Ice |