NCRNA00082 polyclonal antibody View larger

NCRNA00082 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCRNA00082 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about NCRNA00082 polyclonal antibody

Brand: Abnova
Reference: PAB22828
Product name: NCRNA00082 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NCRNA00082.
Isotype: IgG
Gene id: 339541
Gene name: NCRNA00082
Gene alias: MGC33556|p40
Gene description: non-protein coding RNA 82
Immunogen: Recombinant protein corresponding to amino acids of human NCRNA00082.
Immunogen sequence/protein sequence: VLGTMHLEVQYEAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKILSDPSVLQLTPSLPMF
Protein accession: Q6PIY5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22828-48-36-1.jpg
Application image note: Immunohistochemical staining of human small intestine with NCRNA00082 polyclonal antibody (Cat # PAB22828) shows cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy NCRNA00082 polyclonal antibody now

Add to cart