DNAH7 polyclonal antibody View larger

DNAH7 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNAH7 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about DNAH7 polyclonal antibody

Brand: Abnova
Reference: PAB22820
Product name: DNAH7 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DNAH7.
Isotype: IgG
Gene id: 56171
Gene name: DNAH7
Gene alias: DKFZp686C09101|FLJ37196|KIAA0944|MGC39580
Gene description: dynein, axonemal, heavy chain 7
Immunogen: Recombinant protein corresponding to amino acids of human DNAH7.
Immunogen sequence/protein sequence: LKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNY
Protein accession: Q8WXX0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22820-48-303-1.jpg
Application image note: Immunohistochemical staining of human fallopian tube with DNAH7 polyclonal antibody (Cat # PAB22820) shows positivity in cilia at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy DNAH7 polyclonal antibody now

Add to cart