NAP5 polyclonal antibody View larger

NAP5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAP5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about NAP5 polyclonal antibody

Brand: Abnova
Reference: PAB22809
Product name: NAP5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NAP5.
Isotype: IgG
Gene id: 344148
Gene name: NAP5
Gene alias: ERIH2|FLJ34870
Gene description: Nck-associated protein 5
Immunogen: Recombinant protein corresponding to amino acids of human NAP5.
Immunogen sequence/protein sequence: SKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSCASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSD
Protein accession: O14513
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22809-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with NAP5 polyclonal antibody (Cat # PAB22809) shows strong cytoplasmic positivity in Purkinje cells at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy NAP5 polyclonal antibody now

Add to cart