UHRF1BP1 polyclonal antibody View larger

UHRF1BP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UHRF1BP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about UHRF1BP1 polyclonal antibody

Brand: Abnova
Reference: PAB22797
Product name: UHRF1BP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant UHRF1BP1.
Isotype: IgG
Gene id: 54887
Gene name: UHRF1BP1
Gene alias: C6orf107|FLJ20302|ICBP90|dJ349A12.1
Gene description: UHRF1 binding protein 1
Immunogen: Recombinant protein corresponding to amino acids of human UHRF1BP1.
Immunogen sequence/protein sequence: VQSEALAPDSMSHPRSKTEHDLKSLSGLTEVMEILKEGSSGMDNKGPLTELEDVADVHMLVHSPAHVRVRLDHYQYLALLRLKEVLQRLQEQLTKDTESMTGSP
Protein accession: Q6BDS2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22797-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with UHRF1BP1 polyclonal antibody (Cat # PAB22797) shows moderate cytoplasmic positivity in tubular cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy UHRF1BP1 polyclonal antibody now

Add to cart