C2orf30 polyclonal antibody View larger

C2orf30 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C2orf30 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about C2orf30 polyclonal antibody

Brand: Abnova
Reference: PAB22781
Product name: C2orf30 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C2orf30.
Isotype: IgG
Gene id: 27248
Gene name: C2orf30
Gene alias: CL24936|CL25084|ERLECTIN|XTP3-B|XTP3TPB
Gene description: chromosome 2 open reading frame 30
Immunogen: Recombinant protein corresponding to amino acids of human C2orf30.
Immunogen sequence/protein sequence: SDDIPFRVNWPGTEFSLPTTGVLYKEDNYVIMTTAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESYWTYEVCHGKH
Protein accession: Q96DZ1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22781-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with C2orf30 polyclonal antibody (Cat # PAB22781) shows strong nuclear/nucleolar and cytoplasmic positivity in Purkinje cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C2orf30 polyclonal antibody now

Add to cart