LGSN polyclonal antibody View larger

LGSN polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LGSN polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about LGSN polyclonal antibody

Brand: Abnova
Reference: PAB22768
Product name: LGSN polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LGSN.
Isotype: IgG
Gene id: 51557
Gene name: LGSN
Gene alias: GLULD1|LGS|MGC163238|MGC163240
Gene description: lengsin, lens protein with glutamine synthetase domain
Immunogen: Recombinant protein corresponding to amino acids of human LGSN.
Immunogen sequence/protein sequence: IISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCDSGI
Protein accession: Q5TDP6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22768-48-A2-1.jpg
Application image note: Immunohistochemical staining of human colon with LGSN polyclonal antibody (Cat # PAB22768) strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy LGSN polyclonal antibody now

Add to cart